PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G026000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 506aa    MW: 55813.6 Da    PI: 7.6255
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G026000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.12.1e-42166241277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          Cqv gC++dls++k+yh+rhkvCe+hsk+p+v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Manes.01G026000.1.p 166 CQVYGCHKDLSSLKDYHKRHKVCEIHSKTPKVIVNGVEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 241
                          **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-34159227IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.804163240IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.93E-40164243IPR004333Transcription factor, SBP-box
PfamPF031105.9E-32166239IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MEPWRYTAEG KGLLFSDEID FSVDSFGRGR KIFTGWDGES VEGLEFVDLG FSEMPRKPFH  60
GSNPGVGMLG GSEAGINSSK IELASSGYMI ASNSLLESGS KHSTTLLESN SQDSSLIDLK  120
LGRLADGKET QNSKFLKERS VVSSTNPTSQ AKKARTMSSR SQTPYCQVYG CHKDLSSLKD  180
YHKRHKVCEI HSKTPKVIVN GVEQRFCQQC SRFHLLVEFD DGKRSCRKRL AGHNERRRKP  240
QFGPLSGGPH KFLLPYQGNK FVGTSLPKRA SFLFPNILPG GILYPERYEQ TNCYKSVKVD  300
EKSIWGTNMQ SISKPFLPHH ANRIQNTAEI SPSSTEEFTV CNTASTVHEL AGVYNSSRAL  360
SLLSAESQDL GHLAGIIITT PFNSQANRSH QIVGISEKPF GSESSEKNMP IGGHSSELNS  420
IKANHMGSFM VSCAGYAADL QIEPDGFFQE SDLLNAKYCV SAENESTMDL LQLSSHLHRV  480
EEQRNSVQVK HETEDLSTFL TTYGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281662391184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067818.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A067KYV70.0A0A067KYV7_JATCU; Uncharacterized protein
STRINGPOPTR_0008s09750.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-56SBP family protein